PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK07976.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 379aa    MW: 43727.1 Da    PI: 6.9813
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK07976.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.13.6e-5371351128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPt+eelv +yLk+k+++ k++l +vi +vd+yk+ePwd+++     + e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+vls k+
  PK07976.2   7 VPPGFRFHPTEEELVGYYLKRKINALKIDL-DVIIDVDLYKIEPWDIQArcnLGYDEQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAVLS-KN 104
                69****************************.99**************953432233677**************************************.89 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                + +g++ktLvfykgrap+g+k+dW+mheyrl
  PK07976.2 105 RIIGMRKTLVFYKGRAPNGRKSDWIMHEYRL 135
                99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-595156IPR003441NAC domain
PROSITE profilePS5100558.0547156IPR003441NAC domain
PfamPF023652.7E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MEMESCVPPG FRFHPTEEEL VGYYLKRKIN ALKIDLDVII DVDLYKIEPW DIQARCNLGY  60
DEQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAV LSKNRIIGMR KTLVFYKGRA  120
PNGRKSDWIM HEYRLQTSEH APPQEEGWVV CRAFRKPSPS HHQRQGYEMW NHGNYYEREN  180
SSSSSHMMRS LYSSSSPSVE EKHNMADIIN HNPNNVAATS TAFHNCFIPS SSVHVHDQDQ  240
LVYPLPSVDH IHLTTHHHHE VLPQLDSPSI SANLAANNND HQSFQRNNTS CTATNTILNN  300
DHHHHHHDNY ENSSNEIRSS STSTTSQCID WKNMDSFLSS HLSTDHPIIS FVGSDDLPPL  360
VPQNYRQETQ NRHFLGCFX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-49215610168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010094969.11e-146NAC domain-containing protein 7
SwissprotQ9C8W91e-113NAC30_ARATH; NAC domain-containing protein 30
TrEMBLW9QY051e-145W9QY05_9R
STRINGGLYMA20G31551.11e-123(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.13e-89vascular related NAC-domain protein 7